1.68 Rating by CuteStat

dudejaarts.com is 1 decade 1 year old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, dudejaarts.com is SAFE to browse.

PageSpeed Score
39
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: 1 ON 100

Web Server Information

Hosted IP Address:

184.105.154.105

Hosted Country:

United States of America US

Location Latitude:

37.3394

Location Longitude:

-121.895

Websites Hosted on Same IP (i.e. 184.105.154.105)

Domain Default page

- superhometips.com
Not Applicable $ 8.95

Sridevi Kalika Parameshwari Amman Aalayam

- sridevikalikaparameshwariammanaalayam.com
Not Applicable $ 8.95


UltimateDPS for WoW

- dpswow.com
Not Applicable $ 8.95

Supra eDesigns

- webedesign.in
860,687 $ 720.00

Domain Information

Domain Registrar: Nimzo 27, LLC
Registration Date: Oct 6, 2012, 12:00 AM 1 decade 1 year 7 months ago
Last Modified: Oct 6, 2012, 12:00 AM 1 decade 1 year 7 months ago
Expiration Date: Oct 6, 2013, 12:00 AM 1 decade 7 months 6 days ago

Domain Nameserver Information

Host IP Address Country
lion1.hostrightnow.com 184.105.154.105 United States of America United States of America
lion2.hostrightnow.com 184.105.154.108 United States of America United States of America